PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00705g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 266aa    MW: 30277.1 Da    PI: 8.219
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00705g00001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.7e-292172253
                   G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                              +rlrWtp LH++F++a+++LGG++kAtPk +l+lm+v gLt++hvkSHLQ Y
  Peaxi162Scf00705g00001.1 21 ARLRWTPHLHRSFLHAIHKLGGQDKATPKLVLQLMDVRGLTISHVKSHLQNY 72
                              69*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-271773IPR009057Homeodomain-like
PROSITE profilePS5129412.6911777IPR017930Myb domain
SuperFamilySSF466894.3E-142074IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-212273IPR006447Myb domain, plants
PfamPF002498.6E-82272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGNCGRINAG GVRQYTRSKV ARLRWTPHLH RSFLHAIHKL GGQDKATPKL VLQLMDVRGL  60
TISHVKSHLQ NYITPRARME IASCKPEELQ HCSQKICEAV ANRPYRYSGD DYMQTINVER  120
SWAKKRTMEG ETGFTRQQII SDTQKEADSV CHSTSYFPLD FFQSCNLPGN ALQQSENFKL  180
SSVQQDENWE PWKKCKIERL RKIAENEEKL DDERCELSLS LSLHDPCAQT RSNTCSTNEA  240
ISSYSTSSSH ENHTVNLGLS IALCSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766440.12e-62PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLA0A068UA232e-54A0A068UA23_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.18e-32G2-like family protein